- This topic has 4 replies, 2 voices, and was last updated 3 years ago by Sabine Suppmann.
-
AuthorPosts
-
-
November 14, 2019 at 14:16 #2586
Sabine SuppmannModeratorDear All
has anyone ever tried the combination VEGF-N-Strep tag resulting in secretion + proper processing of the signal sequence?
Best
Sabine -
April 23, 2021 at 16:04 #3729
Nick BerrowModeratorHi Sabine,
Sorry I only just saw this post…
We inserted a OneStrep-3C between a signal peptide and a receptor ECD and saw no reduction in secreted protein compared with the C-his version.
We used:
MGILPSPGMPALLSLVSLLSVLLMGCVA¡ETGASWSHPQFEKGGGSGGGSGGGSSWSHPQFEKSSGLEVLFQGP…Which is µphosphatase leader-OneStrep-3C. This worked well for us but we’ve never tried it with VEGF.
Best
Nick -
April 23, 2021 at 22:11 #3732
Sabine SuppmannModeratorHi Nick
better late than never! Tanks, in the meantime I learned that VEGF SS and TwinStrep can work
best
Sabine -
April 23, 2021 at 22:11 #3733
Sabine SuppmannModeratorHi Nick
better late than never! Tanks, in the meantime I learned that VEGF SS and TwinStrep can work
best
Sabine -
April 23, 2021 at 22:11 #3734
Sabine SuppmannModeratorHi Nick
better late than never! Tanks, in the meantime I learned that VEGF SS and TwinStrep can work
best
Sabine
-
-
AuthorPosts
You must be logged in to reply to this topic.